Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEVNKESLVADELHRMFLAGELQIT-VEEDINNISERLRNGDLSLDRLSGEDVFIKETVNEALRRVEQ- 4D4W Chain:A ((1-61)) GPLGSEQ----RMFKRVGCGECAACQVTEDCGACSTCLL--QLPHDVASG--LFCKCERRRCLRIVERS

General information: TITO was launched using: RESULT: Template: 4D4W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 147 -598 -4.06 -10.13 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -4.06 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.098

(partial model without unconserved sides chains): PDB file : Tito_4D4W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4D4W-query.scw PDB file : Tito_Scwrl_4D4W.pdb: