Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLFFPWWVY-LCIVGIIFSAYKLVAAAKEEEKVDQAFIEKEGQIYMERMEKERERRSSQQHEEENQNHSIA 4NKP Chain:A ((112-130)) --GIPIILENVVVGGIGVGGA--------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4NKP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 22 -8609 -391.32 -478.28 target 2D structure prediction score : 0.06 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -391.32 2D Compatibility (Sec. Struct. Predict.) : 0.06 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.710

(partial model without unconserved sides chains): PDB file : Tito_4NKP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4NKP-query.scw PDB file : Tito_Scwrl_4NKP.pdb: