Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------------------MTEIKANSTVMIHVLADETLSSIKREYV--EVDRKTEIGEKIIIVDKNDPDDEYENGAI 2E71 Chain:A ((710-792)) GSSGSSGERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKESGPSSG--

General information: TITO was launched using: RESULT: Template: 2E71.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 82 13003 158.57 236.41 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : 158.57 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.315

(partial model without unconserved sides chains): PDB file : Tito_2E71.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2E71-query.scw PDB file : Tito_Scwrl_2E71.pdb: