Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------MCNRNVITIPYEEDMSKYSILHQVGGRIEYFQKEYSQYP---MFAFDSEEDYNEYKCLIMQLKKNKKVSSFSF
4GJT Chain:C ((2-113))GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRL


General information:
TITO was launched using:
RESULT:

Template: 4GJT.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 162 10595 65.40 151.35
target 2D structure prediction score : 0.27
Monomeric hydrophicity matching model chain C : 0.56

3D Compatibility (PKB) : 65.40
2D Compatibility (Sec. Struct. Predict.) : 0.27
1D Compatibility (Hydrophobicity) : 0.56
QMean score : 0.136

(partial model without unconserved sides chains):
PDB file : Tito_4GJT.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4GJT-query.scw
PDB file : Tito_Scwrl_4GJT.pdb: