Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------MNIFVDQDNYKEVSLKLTKKL-----LTSEHYQFLLCFKGEKLDITISVTPQSLVK-LRDDINELIFMFSD------------------- 1JI8 Chain:A ((1-111)) MPVKCPGEYQVDGKKVILDEDCFMQNPEDWDEKVAEWLARELEGIQKMTEEHWKLVKYLREYWETFGTCPPIKMVTKETGFSLEKIYQLFPSGPAHGACKVAGAPKPTGCV

General information: TITO was launched using: RESULT: Template: 1JI8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 166 10011 60.31 154.02 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 60.31 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.217

(partial model without unconserved sides chains): PDB file : Tito_1JI8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1JI8-query.scw PDB file : Tito_Scwrl_1JI8.pdb: