Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRPLQISAETAQKLAESLN--LPLEQIMHM-------PQHILLAKMAELQKEDKS----- 2KJF Chain:A ((1-60)) LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAIQL

General information: TITO was launched using: RESULT: Template: 2KJF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 115 -8366 -72.75 -181.87 target 2D structure prediction score : 0.87 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -72.75 2D Compatibility (Sec. Struct. Predict.) : 0.87 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.630

(partial model without unconserved sides chains): PDB file : Tito_2KJF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2KJF-query.scw PDB file : Tito_Scwrl_2KJF.pdb: