Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------MNKFYNERSNSKNPSILLKEIVV----KELANARVKIF---LEKVREINLLPN-NVPSSSMSHTSIFVLSPSNIRVVGHG--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4Q05 Chain:A ((34-360))ENSWQIGPRTLPAPSGASDVLYNIISKTPTPVPTINLNLVPRTESEWRAAITQLDEGKVDMAREISKQLSVSVEHGVIEGVSVYYVTPVEVAPDLEDKLFVHTHGGAFVLNGGEAGTIEAIVIATLAKVRVLSIDYRMPPSHPAPAARDDVFTVYQHLLKQGSAQKIALGGSSGGANLTMGLVQHLIEQEVDLPGALFLGTPGADMSKTGDSYYINDGIDRNLVTYDGFLEAAVRLYANGRDLKDPLVSPLYGDLHGFPPTFLITGTRDLLLSATVRTHIKLRQSGVVADLFVYEGIAHGDYAVDLTAPETQHAFAELNAFLLQHLR


General information:
TITO was launched using:
RESULT:

Template: 4Q05.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -1212 for 270 contacts (-4.5/contact) +
2D Compatibility (PS) -8008 + (NN) -6767 + (LL) 0
1D Compatibility (HY) -2000 + (ID) 650
Total energy: -18637.0 ( -69.03 by residue)
QMean score : 0.287

(partial model without unconserved sides chains):
PDB file : Tito_4Q05.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4Q05-query.scw
PDB file : Tito_Scwrl_4Q05.pdb: