Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MADNNKMSREEAGRKGGETTSKNHDKE--FYQEIGQKGGEATSKNHDKEFYQEIGEKGGEATSKNHDKEFYQEIGEKGGEATSENHDKEFYQEIGRKGGEATSKNHDKEFYQEIGSKGGNARNND 4LVN Chain:P ((13-93)) --------------KLRLIVSENHATTPSFFQESLLE----------PDVLSFLESK-GNLSNLKNINSMIIELKED----TTDDELISYIKILEEKGALIESDKLVSAD---------------

General information: TITO was launched using: RESULT: Template: 4LVN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 267 1519 5.69 19.22 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain P : 0.69 3D Compatibility (PKB) : 5.69 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.240

(partial model without unconserved sides chains): PDB file : Tito_4LVN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4LVN-query.scw PDB file : Tito_Scwrl_4LVN.pdb: