Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEPYQRYEELKKKTIKVVQKENYSIRYITQDEASNDLDEFYKQFAQHLLEAALERKAE 1H3O Chain:A ((870-917)) ---FLLQAPLQRRILEIGKKHGI-------TELHPDVVSYVSHATQQRLQNLVEKISE

General information: TITO was launched using: RESULT: Template: 1H3O.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 73 -6352 -87.01 -132.32 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -87.01 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.491

(partial model without unconserved sides chains): PDB file : Tito_1H3O.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1H3O-query.scw PDB file : Tito_Scwrl_1H3O.pdb: