Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------MEVGDKIHNTNEQITALEKKKYQIETTLLEKQRDLLKLETQQNKAKLELLFELSE----VLTQLEGEEWVSATIALRIIKRNKRKYLDLF-DLNDDKAYVNKDKFKFLHDEFFELKQQLNDI----------------
1ZH1 Chain:A ((1-163))FFSCQRGYKGVWRGDGIMQTTCPCGAQITGHVKNGSMRIVGPRTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVTFLVGLNQYLVGSQLPCEPEPDVAV


General information:
TITO was launched using:
RESULT:

Template: 1ZH1.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 506 22069 43.61 188.62
target 2D structure prediction score : 0.22
Monomeric hydrophicity matching model chain A : 0.61

3D Compatibility (PKB) : 43.61
2D Compatibility (Sec. Struct. Predict.) : 0.22
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.082

(partial model without unconserved sides chains):
PDB file : Tito_1ZH1.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1ZH1-query.scw
PDB file : Tito_Scwrl_1ZH1.pdb: