Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MWNEFKAFAMRGNIVDLAIGVVIGGAFGKIVTSLVNDIIMPLVGLLLGGLDFSGLSFTFGDAVVKYGSFIQTIVNFLIISFSIFIVIRTLNGLRRKKEAEEEAAEEAVDAQEELLKEIRDLLKQQAKSPE 4Y7J Chain:D ((24-101)) -FSEFKEFLYEYKVIPLAIAFIMGIASTALIKSFVDNIIMPIITPFV-----ETATVELGPIVISWGAFLGELVNFIII---------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4Y7J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 63 -14986 -237.87 -205.29 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain D : 0.75 3D Compatibility (PKB) : -237.87 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.75 QMean score : -0.052

(partial model without unconserved sides chains): PDB file : Tito_4Y7J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4Y7J-query.scw PDB file : Tito_Scwrl_4Y7J.pdb: