Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------MPKERRSRRRPQPIIRWVSLTLTLLALCQPIQTWRCSLSLGNQQWMTTYNQEAKFFISIDQILEAHNQSPFCPRSPRYTLDFVNGYPKIYWPPPQGRRRFGARAMVTYDCEPRCPYVGADHFDCP-----HWDNASQADQGSFYV--NHQTLFLHLKQCHGIF--TLTWEIWGYDPLITFSLHKIPDPPQ
1DTO Chain:A ((0-201))HMETLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLECAIYYKAREMGFKHINHQVVPTLAVSKNKALQAIELQLTLETIYNSQY--SNEKWTLQDVS-LEVYLTAPTGCIKKHGYTVEVQFDGDNTMHYTNWTHIYICEEASVTVVEGQVDYYGLYYVHEGIRTYFVQFKDDAEKYSKNKVWEVHAGGQVILCPTSVFS----


General information:
TITO was launched using:
RESULT:

Template: 1DTO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -64 for 1174 contacts (-0.1/contact) +
2D Compatibility (PS) -17816 + (NN) -1411 + (LL) -752
1D Compatibility (HY) 9200 + (ID) 350
Total energy: -11193.0 ( -9.53 by residue)
QMean score : -0.041

(partial model without unconserved sides chains):
PDB file : Tito_1DTO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1DTO-query.scw
PDB file : Tito_Scwrl_1DTO.pdb: