Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMLKSINHICFSVRNLNDSIHFYRDILLGKLLLTGKKTAYFELAGLWIALNEEKDIPRNEIHFSYTHIAFTIDDSEFKYWHQRLKDNNVNILEGRVRDIRDRQSIYFTDPDGHKLELHTGTLENRLNYYKEAKPHMTFYK
4JH9 Chain:B ((1-138))MLNGINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKPHMTFY-


General information:
TITO was launched using:
RESULT:

Template: 4JH9.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -57951 for 864 contacts (-67.1/contact) +
2D Compatibility (PS) -14595 + (NN) -2341 + (LL) 64
1D Compatibility (HY) -17600 + (ID) 4350
Total energy: -96773.0 ( -112.01 by residue)
QMean score : 0.407

(partial model without unconserved sides chains):
PDB file : Tito_4JH9.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4JH9-query.scw
PDB file : Tito_Scwrl_4JH9.pdb: