Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMGDKIAVIPGTFDPITNGHLDIIERAAKIFDVLYVSVLNNSSKKPLFTIEERMEMIRQVTAHLPNVQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETFFVMTNTKYSFLSSSMVKEVAQYQGDISELVPEIVNKAVQAKFK
4NAT Chain:B ((1-160))MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLK----EGTFSLEERMDLIEQSVKHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK


General information:
TITO was launched using:
RESULT:

Template: 4NAT.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -96323 for 1194 contacts (-80.7/contact) +
2D Compatibility (PS) -16589 + (NN) -4341 + (LL) -72
1D Compatibility (HY) -19600 + (ID) 4650
Total energy: -141575.0 ( -118.57 by residue)
QMean score : 0.509

(partial model without unconserved sides chains):
PDB file : Tito_4NAT.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4NAT-query.scw
PDB file : Tito_Scwrl_4NAT.pdb: