Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYSLVSLALSYITLIVVRKRKESGN 3ZJ2 Chain:A ((1-71)) -GSVQTGIVLCKFGAL----CSNPSCPFGHPTPANEDAKVIDLMWCDKNLTCDNPECRKAHSSLSKIK------EVKPISQK

General information: TITO was launched using: RESULT: Template: 3ZJ2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 291 -32667 -112.26 -460.09 target 2D structure prediction score : 0.23 Monomeric hydrophicity matching model chain A : 0.51 3D Compatibility (PKB) : -112.26 2D Compatibility (Sec. Struct. Predict.) : 0.23 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.241

(partial model without unconserved sides chains): PDB file : Tito_3ZJ2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ZJ2-query.scw PDB file : Tito_Scwrl_3ZJ2.pdb: