Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MG-------------GLQTTGYAENASFSQLSAC---FSSRLVREDLFLMFSAYNQFTLLHSRLTMISYNGDDQ----------- 2LV2 Chain:A ((1-85)) MGHHHHHHSHMGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINKCHPSENR

General information: TITO was launched using: RESULT: Template: 2LV2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 113 -11229 -99.37 -193.59 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -99.37 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.123

(partial model without unconserved sides chains): PDB file : Tito_2LV2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LV2-query.scw PDB file : Tito_Scwrl_2LV2.pdb: