Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDKLTKEELIFLVKELMNPTL-DDEKVSEYLDLLEKNVPYPAPSDLIFWSNE--DYTAEQVVKIALNYKDE 3U43 Chain:A ((8-76)) -SDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRA-

General information: TITO was launched using: RESULT: Template: 3U43.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 189 -29256 -154.79 -443.27 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain A : 0.77 3D Compatibility (PKB) : -154.79 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.752

(partial model without unconserved sides chains): PDB file : Tito_3U43.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3U43-query.scw PDB file : Tito_Scwrl_3U43.pdb: