Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MRMSLIGERFTEEEQKL-LLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDRFRFEN-- 4OB4 Chain:A ((3-71)) SEYAKQLGAKLRAIRTQQGLSLHGVEEKSQGRWKAVVVGSYERGDRAVTVQRLAELADFYGVPVQELLP

General information: TITO was launched using: RESULT: Template: 4OB4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 212 -16565 -78.14 -254.85 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -78.14 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.337

(partial model without unconserved sides chains): PDB file : Tito_4OB4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OB4-query.scw PDB file : Tito_Scwrl_4OB4.pdb: