Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------MIHKNWLEKETIKKVKCVQTNA-KKYIVNRVLTPGKEYEVKNETEEFLFVVDNTNKVGGYYKEYFEEM-------------------
3N7C Chain:A ((503-614))EEVLFCEKAKLLIFDSGYTSRGVGELKLLRKKDDKGKVRVLCRSGMGHVLLNTSVVKSFKYQPIDADNENLIKWPIIT--DGKLETFIIKVKQKADGRRLVGAVADAQQA


General information:
TITO was launched using:
RESULT:

Template: 3N7C.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 197 11418 57.96 175.65
target 2D structure prediction score : 0.40
Monomeric hydrophicity matching model chain A : 0.61

3D Compatibility (PKB) : 57.96
2D Compatibility (Sec. Struct. Predict.) : 0.40
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.252

(partial model without unconserved sides chains):
PDB file : Tito_3N7C.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3N7C-query.scw
PDB file : Tito_Scwrl_3N7C.pdb: