Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRLIKLEQPNCNPCKMVSNYLEQV------NIQFETVDVTQEPEVAARFGVMGVPVTILLSDQGEEVNRSVGFKPNE-LDELLKELR 1V98 Chain:B ((52-134)) LTLVDFFAPWCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVP-TLVLFRRGAPVATWVGASPRRVLEERLR---

General information: TITO was launched using: RESULT: Template: 1V98.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 275 -251 -0.91 -3.30 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain B : 0.80 3D Compatibility (PKB) : -0.91 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.725

(partial model without unconserved sides chains): PDB file : Tito_1V98.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1V98-query.scw PDB file : Tito_Scwrl_1V98.pdb: