Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------------------------------MNITQYEKLKQHLSDEDTGPFTLNEFSFYMKEDDRYIHIPVFE- 2LU7 Chain:A ((1-82)) MTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEP

General information: TITO was launched using: RESULT: Template: 2LU7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 51 3042 59.65 70.74 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : 59.65 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.185

(partial model without unconserved sides chains): PDB file : Tito_2LU7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LU7-query.scw PDB file : Tito_Scwrl_2LU7.pdb: