Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMRLLVTGGAGFIGTNFVHSAVREHPDDAVTVLDALTYAGRRESL-ADVEDAIRLVQGDITDAELVSQLVAESDAVVHFAAESHVDNALDNPEPFLHTNVIGTFTILEAVRRHGVRLHHISTDEVYGDLELDD---------RARFTESTPYNPSSPYSATKAGADMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRRPKLYGAGANVRDWIHVDDHNSAVRRILDRGRIGRTYLISSEGERDNLTVLRTLLRLMDRDPDDFDHVTDRVGHDLRYAIDPSTLYDELCWAPKHTDFEEGLRTTIDWYRDNESWWRPLKDATEARYQERGQ
1KEP Chain:B ((6-342))-NIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAK---


General information:
TITO was launched using:
RESULT:

Template: 1KEP.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -120712 for 2793 contacts (-43.2/contact) +
2D Compatibility (PS) -34790 + (NN) -12958 + (LL) 256
1D Compatibility (HY) -33200 + (ID) 10200
Total energy: -211604.0 ( -75.76 by residue)
QMean score : 0.492

(partial model without unconserved sides chains):
PDB file : Tito_1KEP.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1KEP-query.scw
PDB file : Tito_Scwrl_1KEP.pdb: