Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceAITCGQVSSAIAPCLSYARGMGSAPSAGCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSR
1BWO Chain:A ((1-89))-IDCGHVDSLVRPCLSYVQGG-PGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSR


General information:
TITO was launched using:
RESULT:

Template: 1BWO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -43934 for 606 contacts (-72.5/contact) +
2D Compatibility (PS) -9459 + (NN) -3441 + (LL) -28
1D Compatibility (HY) -8800 + (ID) 2550
Total energy: -68212.0 ( -112.56 by residue)
QMean score : 0.593

(partial model without unconserved sides chains):
PDB file : Tito_1BWO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1BWO-query.scw
PDB file : Tito_Scwrl_1BWO.pdb: