Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------------------------------------------------VKFDLENGYVVKADGEMLVGGKFVVFKDSMKNWEPPYENKKLSESEVQEIIQQVK-QSTNENT-VQISFE------------------------------------------------------------------------
1I7F Chain:A ((4-231))HDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLKFDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLK---TLVGNGYVVITITPSEG-ERYQGVVGLEGDTLAADLEDYFMRSEQLPTRLFIRTGDVDGKPAAGGMLLQVMPAQNAQQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKCT


General information:
TITO was launched using:
RESULT:

Template: 1I7F.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -354 for 305 contacts (-1.2/contact) +
2D Compatibility (PS) -6583 + (NN) 3523 + (LL) 52
1D Compatibility (HY) -2000 + (ID) 450
Total energy: -5812.0 ( -19.06 by residue)
QMean score : 0.288

(partial model without unconserved sides chains):
PDB file : Tito_1I7F.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1I7F-query.scw
PDB file : Tito_Scwrl_1I7F.pdb: