Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKKVCFVCLGNICRSPMAEFVMANLDKEDSLSVE--SRATSTWEHGNPIHRGTQAILQRYQIPYINDKGSQPISKDDLAYFDYIIGMDEQNVKDLKALSQGTYDDKISLFCDGG------VPDPWYTGD--FEETYRLVNDGCKQWLTLINNSRD
4LRQ Chain:D ((1-146))MQKVLVVCMGNICRSPTAEAVLRAKAAQLKVDVEVDSAGTIGYHQGNPPDARSKAAGEKRGYSFSGIK-ARKIRDEDFVKFDWILAADQENLAELKARCPQSHQHKLSLMLSHSDSEYQEIPDPYYGGERGFELVLDLVEDAAEQFLLK------


General information:
TITO was launched using:
RESULT:

Template: 4LRQ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -78656 for 1143 contacts (-68.8/contact) +
2D Compatibility (PS) -14673 + (NN) -5657 + (LL) 72
1D Compatibility (HY) -9600 + (ID) 2450
Total energy: -110964.0 ( -97.08 by residue)
QMean score : 0.423

(partial model without unconserved sides chains):
PDB file : Tito_4LRQ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4LRQ-query.scw
PDB file : Tito_Scwrl_4LRQ.pdb: