Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------------------------------------------MAKPKKKKFEVTEQQTIDAVLQQMKEEGYLPVRRMEEPIFMEKKENGSIQIVPCGKKIVFEGKLI---------------------- 2HRV Chain:A ((1-139)) GPSDMYVHVGNLIYRNLHLFNSEMHESILVSYSSDLIIYRTNTVGDDYIPSCDCTQATYYCKHKNRYFPIT---VTSHDWYEIQESEYYPKHIQYNLLIGEGPCEPG----DCGGKLLCKHGVIGIVTAGGDNHVAFIDLRHFHCA

General information: TITO was launched using: RESULT: Template: 2HRV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 146 -9116 -62.43 -157.16 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -62.43 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.349

(partial model without unconserved sides chains): PDB file : Tito_2HRV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2HRV-query.scw PDB file : Tito_Scwrl_2HRV.pdb: