Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDKLTKEELIFLVKELMNPTL--DDEKVSEYLDLLEKNVPYPAPSDLIFWSN---------EDYTAEQVVKIALNYKDE 2K0D Chain:X ((8-84)) -SDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTALIYEAAARAAANPGGDGGGPEGIVKEIKEWRA-

General information: TITO was launched using: RESULT: Template: 2K0D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 241 -24507 -101.69 -371.31 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain X : 0.69 3D Compatibility (PKB) : -101.69 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.599

(partial model without unconserved sides chains): PDB file : Tito_2K0D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2K0D-query.scw PDB file : Tito_Scwrl_2K0D.pdb: