Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIHKNWLEKETIKKVKCVQTNAKKYIVNR----------------VLTPGKEYEVKNETEEFLFVV------------DNTNKVGGYYKEYFEEM----- 2JVU Chain:A ((1-98)) --GGSGWNADNVDPSQCIKQSGVQYTYNSGVSVCMQGLNEGKVRGVSVSGVFYYNDGTTSNFKGVVTPSTPVNTNQDINKTNKVGVQKYRALTEWVGSRS

General information: TITO was launched using: RESULT: Template: 2JVU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 162 3563 21.99 54.81 target 2D structure prediction score : 0.26 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 21.99 2D Compatibility (Sec. Struct. Predict.) : 0.26 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.041

(partial model without unconserved sides chains): PDB file : Tito_2JVU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JVU-query.scw PDB file : Tito_Scwrl_2JVU.pdb: