Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYL-ELNADYLHTMATFD-EAWDQYESE--VHGR 1ITP Chain:A ((1-77)) -GSAGKFIVIFKNDVSEDKIRETKDEVIAEGGTITNEYNMPGMKGFAGELTPQSLTKFQGLQGDLIDSIEEDGIVTTQ

General information: TITO was launched using: RESULT: Template: 1ITP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 307 3941 12.84 53.99 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : 12.84 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.409

(partial model without unconserved sides chains): PDB file : Tito_1ITP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ITP-query.scw PDB file : Tito_Scwrl_1ITP.pdb: