Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEGWPKQ------------------------------------------------------------------------------------------------------------ 3ETI Chain:A ((34-201)) DLILPFYKAGKVSFYQGDLDVLINFL--EPDVLVNAANGDLRHVGGV---ARAIDVFTGGKLTKRSKEYLKSSKAIAPGNAVLFENVLEHLSVMNAVGPRNGDSRVEGKLCNVYKAIAKCDGKILTPLISVGIFKVKLEVSLQCLLKTVTDRDLNVFVYTDQERVTIENFFNG

General information: TITO was launched using: RESULT: Template: 3ETI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 145 9912 68.36 168.00 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : 68.36 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.142

(partial model without unconserved sides chains): PDB file : Tito_3ETI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ETI-query.scw PDB file : Tito_Scwrl_3ETI.pdb: