Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence M--IKVEIGQCLIPELCRKKDITINELSEITGIKKQQLSDYNRLVKVDMSIRTAKRIAAALDCNVEDLYEFKVERH- 3B7H Chain:A ((1-76)) MKTDGEFVSE-HLMELITQQNLTINRVATLAGLNQSTVNAMFEGRSKRPTITTIRKVCGTLGISVHDFFDFPPYNEV

General information: TITO was launched using: RESULT: Template: 3B7H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 256 15623 61.03 214.01 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.75 3D Compatibility (PKB) : 61.03 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.673

(partial model without unconserved sides chains): PDB file : Tito_3B7H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3B7H-query.scw PDB file : Tito_Scwrl_3B7H.pdb: