Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------MKLWMRKTLVVLFTIVTFGLVSPPAALMADKPSGQPSSLEQND--------YTAFYDEHDL----------------YDDESDDRRDPELLFQSYKEQLLD----SAEDQSFLKFGSRIAPVIEDDYRKEILPKIENVISDYLATLQDD---------EAYQDVVISSMPSAGKTEKIFNVYNRTTGEDLLRFHVRRDHPPHDGYWFNFHYHTAEDGFQSHHELGSIYWDRNTPPNWMSA----------------
2ZIH Chain:A ((62-343))INIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYG--ANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDM


General information:
TITO was launched using:
RESULT:

Template: 2ZIH.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 819 31835 38.87 158.38
target 2D structure prediction score : 0.52
Monomeric hydrophicity matching model chain A : 0.55

3D Compatibility (PKB) : 38.87
2D Compatibility (Sec. Struct. Predict.) : 0.52
1D Compatibility (Hydrophobicity) : 0.55
QMean score : 0.229

(partial model without unconserved sides chains):
PDB file : Tito_2ZIH.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2ZIH-query.scw
PDB file : Tito_Scwrl_2ZIH.pdb: