Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNAISLAVDQ--FVAVLTIHNPPA-NALSSRILEELSSCLDQCETDAGVRSIIIHGEGRFFSAGADIKEFTSLKGNEDSSLLAERGQQL--MERIESFPKPIIAAIHGAALGGGLELAMACHIRIAAEDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALELIGSGEPISGKEALDLGLVSIGAKDEAEVIEKAKALAAKFAEKSPQTLASLLELLYSNKVYS-YEGSLKLEAKRFGEAFESEDAKEGIQAFLEKRKPQFKGE
2QQ3 Chain:I ((5-258))---VSIAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGADIQEMA-----KDDPIRLEWLNQFADWDRLSIVKTPMIAAVNGLALGGGFELALSCDLIVASSAAEFGFPEVNLGVMPGAGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSPEL-LMEETMRLAGRLAEQPPLALRLIKEAVQKAVDYPLYEG-MQFERKNFYLLFASEDQKEGMAAFLEKRKPRFQGK


General information:
TITO was launched using:
RESULT:

Template: 2QQ3.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 1210 3812 3.15 15.37
target 2D structure prediction score : 0.60
Monomeric hydrophicity matching model chain I : 0.83

3D Compatibility (PKB) : 3.15
2D Compatibility (Sec. Struct. Predict.) : 0.60
1D Compatibility (Hydrophobicity) : 0.83
QMean score : 0.458

(partial model without unconserved sides chains):
PDB file : Tito_2QQ3.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2QQ3-query.scw
PDB file : Tito_Scwrl_2QQ3.pdb: