Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLVLSRKINEAIQIGADIEVKVIAVEGDQVKLGIDAPKHIDIHRKEIYLTIQEENNRAAALSSDVISALSSQKK 2MFC Chain:C ((1-52)) MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQ----------------------

General information: TITO was launched using: RESULT: Template: 2MFC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 110 -19775 -179.77 -380.29 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain C : 0.82 3D Compatibility (PKB) : -179.77 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.421

(partial model without unconserved sides chains): PDB file : Tito_2MFC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MFC-query.scw PDB file : Tito_Scwrl_2MFC.pdb: