Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------------MANEFRVC----------DDCQATNIKTLLPRLKEVDPDA---KVEVGCQSYCGPGRKKSFAFVNNRPLSAPTEDELIDKVKKKIKK 1QQG Chain:A ((159-262)) AFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPG--EFWMQVDDSVVAQNMHETILEAMRAMSD-

General information: TITO was launched using: RESULT: Template: 1QQG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 245 11237 45.86 158.26 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : 45.86 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.388

(partial model without unconserved sides chains): PDB file : Tito_1QQG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1QQG-query.scw PDB file : Tito_Scwrl_1QQG.pdb: