Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------------------------------MILYTVMPQEIVFAEQNQETSAHEQIEYKG----VPLLVEMKGNEAEVIQIMSTNP----MHFLH--PDISPGQKLKLNV
2Y9W Chain:C ((9-150))LDLPGTRILNGANWANNSATSGTLIIFDQSTPGQDADRWLIHNYLDGYKIFNMGSNNWASVSRGNTVLGVSEFDGQTCKWSIEYSGNGEEFWIRVPREGGGGAVWTIKPASSQGPTTVFLDLLKETDPNQRIKFAV


General information:
TITO was launched using:
RESULT:

Template: 2Y9W.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 225 -19910 -88.49 -284.42
target 2D structure prediction score : 0.71
Monomeric hydrophicity matching model chain C : 0.61

3D Compatibility (PKB) : -88.49
2D Compatibility (Sec. Struct. Predict.) : 0.71
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.284

(partial model without unconserved sides chains):
PDB file : Tito_2Y9W.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2Y9W-query.scw
PDB file : Tito_Scwrl_2Y9W.pdb: