Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------QAPPPPQCDPGLLSPCAAPIFFGTAP-----SASCCSSLKAQQGCFCQYAKDPTYASYI-----NSTNARKMIAACGIPLPNCG-----------------------------------------------------
1KNG Chain:A ((50-193))RPAPQTALPPLEGLQADNVQVPGLDPAAFKG-KVSLVNVWASWCVPCHDEAPLLTELGKDKRFQLVGINYKDAADNARRFLGRYGNPFGRVGVDANGRASIEWGVYGVPETFVVGREGTIVYKLVGPITPDNLRSVLLPQMEKAL


General information:
TITO was launched using:
RESULT:

Template: 1KNG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -28757 for 429 contacts (-67.0/contact) +
2D Compatibility (PS) -7841 + (NN) -5938 + (LL) 52
1D Compatibility (HY) -3600 + (ID) 750
Total energy: -46834.0 ( -109.17 by residue)
QMean score : 0.193

(partial model without unconserved sides chains):
PDB file : Tito_1KNG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1KNG-query.scw
PDB file : Tito_Scwrl_1KNG.pdb: