Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------MTKQVQQSRELVLKEIMQSQGVTRTKACSILKELEEFGLFQFSDSGQFMLKVGA--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1MKM Chain:A ((4-249))MNTLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYVPGYKLIEYGSFVLRRFNIRDIAHDHLVDIMKRTGETVHLILKDGFEGVYIDKVEGEQSIPMVSRLGMKVDLYSTASGKSILAFVPEKELKEYLKIVELKPKTPNTITNPRVLKRELEKIRKRGYAVDNEENEIGIMCVGVPIFDHNGYPVAGVSISGVARKFTEEKIEEYSDVLKEKAEEISRKLGY


General information:
TITO was launched using:
RESULT:

Template: 1MKM.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -18562 for 345 contacts (-53.8/contact) +
2D Compatibility (PS) -5885 + (NN) -3080 + (LL) 0
1D Compatibility (HY) -4000 + (ID) 400
Total energy: -31927.0 ( -92.54 by residue)
QMean score : 0.736

(partial model without unconserved sides chains):
PDB file : Tito_1MKM.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1MKM-query.scw
PDB file : Tito_Scwrl_1MKM.pdb: