Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTFTIFNQSFLGWAVVYSLVSLALSYITLIVVRKRKESGN 1M45 Chain:B ((1-25)) --------------------------------------------------------QISQAIKYLQNNIKGFIIRQRVNDE-

General information: TITO was launched using: RESULT: Template: 1M45.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 5 -1473 -294.50 -58.90 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain B : 0.40 3D Compatibility (PKB) : -294.50 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.40 QMean score : 0.152

(partial model without unconserved sides chains): PDB file : Tito_1M45.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1M45-query.scw PDB file : Tito_Scwrl_1M45.pdb: