Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTLYSKKDIVQQARNLAKMISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHYEKHEALKQVEAKIDALQEELEEIPVIQEFRDSQMEVNDLLQLVAHTISNQVTNEIITSTGGDLLKGETGSKVKHSNNSCSL 2KNP Chain:A ((10-17)) -----------------------------------------------------------------------------------------------------------------------------FRSCGGGC----------

General information: TITO was launched using: RESULT: Template: 2KNP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 88 44.00 11.00 target 2D structure prediction score : 1.00 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : 44.00 2D Compatibility (Sec. Struct. Predict.) : 1.00 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 1.028

(partial model without unconserved sides chains): PDB file : Tito_2KNP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2KNP-query.scw PDB file : Tito_Scwrl_2KNP.pdb: