Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------------------------------------------------------------------------------------------------------------------------------MKKMRKRSFHELVMENKKELMTNTEYLNQLEEKLEQRFKQK---- 1VHR Chain:A ((7-184)) SVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNR-EIGPNDGFLAQLCQLNDRLAKEGKLKP

General information: TITO was launched using: RESULT: Template: 1VHR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 50 6980 139.59 174.49 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : 139.59 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.400

(partial model without unconserved sides chains): PDB file : Tito_1VHR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1VHR-query.scw PDB file : Tito_Scwrl_1VHR.pdb: