Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------MKSFYHYLLKYRH--PKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQYESEVHGR
1NWM Chain:X ((190-301))LRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSSSEDLMKELYQRCER--MRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGE


General information:
TITO was launched using:
RESULT:

Template: 1NWM.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 86 8453 98.28 117.40
target 2D structure prediction score : 0.79
Monomeric hydrophicity matching model chain X : 0.68

3D Compatibility (PKB) : 98.28
2D Compatibility (Sec. Struct. Predict.) : 0.79
1D Compatibility (Hydrophobicity) : 0.68
QMean score : 0.345

(partial model without unconserved sides chains):
PDB file : Tito_1NWM.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1NWM-query.scw
PDB file : Tito_Scwrl_1NWM.pdb: