Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------------------------------------------------------------------------MKCIQIEMSFTDEYGQ--VTRLNKTYKPSIIEEHKGEIPRL-LLDDF-KRFLSSLGFNEKQVSRIVTED 1O22 Chain:A ((6-154)) ILEILYYKKGKEFGILEKKMKEIFNETGVSLEPVNSELIGRIFLKISVLEEGEEVPSFAIKALTPKENAVDLPLGDWTDLKNVFVEEIDYLDSYGDMKILSEKNWYKIYVPYSSVKKKNRNELVEEFMKYFFESKGWNPGEYTFSVQEI

General information: TITO was launched using: RESULT: Template: 1O22.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 82 6605 80.55 101.62 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : 80.55 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.393

(partial model without unconserved sides chains): PDB file : Tito_1O22.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1O22-query.scw PDB file : Tito_Scwrl_1O22.pdb: