Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNWVPSMRKLSDELLIESYFKATEMNLNRDF--IELIENEIKRRSLGHIISVSS 1PX0 Chain:A ((90-132)) -----------DKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITS

General information: TITO was launched using: RESULT: Template: 1PX0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 35 735 20.99 17.91 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 20.99 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.379

(partial model without unconserved sides chains): PDB file : Tito_1PX0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1PX0-query.scw PDB file : Tito_Scwrl_1PX0.pdb: