Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLVLSRKINEAIQIGADIEVKVIAVEGDQVKLGIDAPKHIDIHRKEIYLTIQEENNRAAALSSDVISALSSQKK 2JPP Chain:B ((1-52)) MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQ----------------------

General information: TITO was launched using: RESULT: Template: 2JPP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 105 -18075 -172.14 -347.60 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain B : 0.82 3D Compatibility (PKB) : -172.14 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.330

(partial model without unconserved sides chains): PDB file : Tito_2JPP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JPP-query.scw PDB file : Tito_Scwrl_2JPP.pdb: