Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---MLVNSKEIVMKELLDRY---------MDQLHMACTCQVCQNDVLALSLNKVSP-SYVTDFKKIAYTK-----AELVDKQKNTAMLVILAESAAVVSE----SPSDLCQTKQEEAFIN--
3DT5 Chain:A ((15-133))RLKAIEDRLEKFYIPLIKAFSSYVYTAQTEDEIETIITCR---RYLAGNNLLRVLPMHFKFKADKIAGSANWTFYAKEDFEQWKEALDVLWEEFLEVLKEYYTLSGTEISLPEKPDWLIGYK


General information:
TITO was launched using:
RESULT:

Template: 3DT5.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 291 20527 70.54 216.07
target 2D structure prediction score : 0.37
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : 70.54
2D Compatibility (Sec. Struct. Predict.) : 0.37
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.402

(partial model without unconserved sides chains):
PDB file : Tito_3DT5.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3DT5-query.scw
PDB file : Tito_Scwrl_3DT5.pdb: