Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMGHYSHSDIEEAVKS-------AKKEGLKDYLYQEPHG-------------------KKRSHKKSHRTHKK--SRSHKKSYCSHKKSRSHKKSFCSHKKSRSHKKSYCSHKKSRSHKKSYRSHKKSRSYKKSYRSYKKSRSYKKSCRSYKKSRSYKKSYCSHKKKSRSYKKSCRTHK-KSYRSHK---------------KYYKKPHHH-------CDDYKRHDDYDSKKEYWKDG-NCWVVKKKYK---------------
4IAP Chain:A ((5-260))-GRYLQGYLLKKRRVDNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKR-WDEAAVNLAKSRWYNQT----PNRAKRVITTFRTGTWDAYVDQGFKKRFFTLDFRYGTLSYYLNDHNQTCRGEIVISLSSVSANKKDKIIIIDSGMEVWVLKATTKENWQSWVDALQTCFD


General information:
TITO was launched using:
RESULT:

Template: 4IAP.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 773 100328 129.79 530.84
target 2D structure prediction score : 0.51
Monomeric hydrophicity matching model chain A : 0.62

3D Compatibility (PKB) : 129.79
2D Compatibility (Sec. Struct. Predict.) : 0.51
1D Compatibility (Hydrophobicity) : 0.62
QMean score : 0.111

(partial model without unconserved sides chains):
PDB file : Tito_4IAP.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4IAP-query.scw
PDB file : Tito_Scwrl_4IAP.pdb: