Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------MHPTLSWRHLPTRGGEPKRLRIPLSFASIAW----FLTLTITPQASSKRLIDSSNPHRPLSLTWLIIDPDTGVTVNSTRGVAPRGTWWPELHFCLRLINPAVKSTPPNLVRSYGFYCCPGTEKEKYCGGSGESFCRRWSCVTSNDGDWKWPIS-------------LQDRVKFSFV-NSGPGKYKVMKLYKDKSCSPSDLDYLKISFTEKGKQENIQKWINGMS-----WGIVFYKY---GGGAGSTLTIRLRIETGTEPPVAVG----------------
2Z1P Chain:A ((31-325))SELSKSSIVDKVELDHTTLYQGEMTSIKVSFSDKENQKKPGDTITLTLPDALVGMTENDSSPRKINLNGLGEVFIYKDHVVATFNEKVESNVNGHFSFGIKTLITNSSPNVIETDFGTA------TATQRLTIEGVRDYPFFYKVGDLAGESNQVRWFLNVNLNKSDVTEDISIADRQGSGQQLNKESFTFDIVNDKETKYISLAEFEQQGYGKIDFVTDNDFNLRFYRDKARFTSFIVRYTSTITEAGQHQATFENSYDINYQLNNQDATNEKNTSQVKNVFVEGEA


General information:
TITO was launched using:
RESULT:

Template: 2Z1P.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -30036 for 1517 contacts (-19.8/contact) +
2D Compatibility (PS) -25315 + (NN) -7816 + (LL) 256
1D Compatibility (HY) -1600 + (ID) 1350
Total energy: -65861.0 ( -43.42 by residue)
QMean score : 0.081

(partial model without unconserved sides chains):
PDB file : Tito_2Z1P.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2Z1P-query.scw
PDB file : Tito_Scwrl_2Z1P.pdb: