Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMLPDKIIYEGKAKFIIETKDPLTVIQYFKDEVTAFNKEKYKIIEGKGTINNRISTFIMETLEKAGINTHFIKTLSEREQLVKKLKIIPLEIVVRNIAAGSFCKRFNIKEGEKLAFPIIEFFYKNDGLADPMVNENHVLYFGWLSYEEMEEIKTITIKINTVLIDLFLNAGIDLVDLKLEFGRPINDNTKITLADEISPDNCRLWDKNTHKKLDKDVFRLNLGNLKEAYLEVAKRLSVKLC
2GQS Chain:B ((7-236))------LYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSKLAEAGIPTQMERLLSDTECLVKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKANDVLKKLFDDAGLILVDFKLEFGLY---KGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRLGVQLD


General information:
TITO was launched using:
RESULT:

Template: 2GQS.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -84539 for 1828 contacts (-46.2/contact) +
2D Compatibility (PS) -24627 + (NN) -4489 + (LL) 484
1D Compatibility (HY) -21200 + (ID) 5450
Total energy: -139821.0 ( -76.49 by residue)
QMean score : 0.348

(partial model without unconserved sides chains):
PDB file : Tito_2GQS.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2GQS-query.scw
PDB file : Tito_Scwrl_2GQS.pdb: