Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMLTVYGHRGLPSKAPENTIASFKAASEVEGINWLELDVAITKDEQLIIIHDDYLERTTNMSGEITELNYDEIKDASAGSWFGEKFKDEHLPTFDDVVKIANEYNMNLNVELKGITGPNGLALSKSMVKQVEEQLTNLNQNQ-EVLISSFNVVLVKLAEEIMPQYNRAVIFHTTSFREDWRTLLDYCNAKIVNTEDAKLTKAKVKMVKEAGYELNVWTVNKPARANQLANWGVDGIFTDNADKMVHLSQ
3QVQ Chain:A ((9-248))LPQVIAHRGSSGQAPENTLASLHLAGQ-QGIKWVEIDVMLSGDGIPVIFHDDYLSRTTDGDGLIYKTPLAELKQLDAGSWKGQEYQQETIPTLLEAIEVISQYGMGLNLELKPCEGLE-----EETIAASVEVLKQHWPQDLPLLFSSFNYFALVSAKALWPEIARGYNVSAI--PSAWQERLEHLDCAGLHIHQSFFDVQQVSDIKAAGYKVLAFTINDESLALKLYNQGLDAVFSDYPQKIQSAID


General information:
TITO was launched using:
RESULT:

Template: 3QVQ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -78500 for 2100 contacts (-37.4/contact) +
2D Compatibility (PS) -26224 + (NN) -13029 + (LL) 592
1D Compatibility (HY) -16000 + (ID) 3750
Total energy: -136911.0 ( -65.20 by residue)
QMean score : 0.519

(partial model without unconserved sides chains):
PDB file : Tito_3QVQ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3QVQ-query.scw
PDB file : Tito_Scwrl_3QVQ.pdb: